Words That Rhyme with Antibody (200 Results)
4 syllablesA E 1 N T I H 0 B A A 2 D I Y 0
2 syllables(78)
onlyanymanyveryearlycountrybodyreallycitymoneystudypartysimplylikelystoryreadynearlymerelytheoryeasyclearlyslowlyheavydailyhardlyprettyhighlyhappycarryquicklyslightlyfullycoffeetwentycountymaybebeautylargelyemptycloselyfiftyjurygreatlyfriendlyarmybusydutybabyfairlytrulyworrywidelyplentyfirmlytinyladyvalleypartlysafetysorrylovelyangrysteadydeeplyfunnyrarelysurelycopymostlysharplybrieflystronglydirtyvarybadlyhealthynamelycrazy
3 syllables(55)
everyfamilyhistoryalreadypolicycenturyindustryespeciallypropertydirectlyfinallysuddenlycertainlyqualitycompletelyrecentlyeasilyexactlyenergyprimaryenemyfrequentlycarefullypoetrycommitteememoryfacultyunityrapidlyequallyheavilypossiblyvictoryproperlyextremelytendencyagencyquietlypracticallytragedyarterycontrarypreciselysomebodyreadilyconstantlysalarythoroughlycomedymysterydignitynormallyopenlysympathyquantity
4 syllables(53)
necessarycommunitymilitarysocietyusuallyactuallygenerallyactivityapparentlyentirelyobviouslyrelativelyvarietyauthoritycapacityphilosophydifficultyeconomyliterarysecurityordinaryprimarilyeverybodymachinerymajorityintensitynaturallypreviouslydictionaryefficiencytestimonyseriouslyessentiallygraduallyincreasinglysufficientlyvirtuallyanxietyanybodynecessitysecretarysatisfactoryeffectivelymaturityspecificallysubstantiallyaccuracypersonallytechnologypresumablyreasonablydiscoveryemergency
5 syllables(13)
6 syllables(1)
More 4-Syllable Words Starting with "A"
Songwriting Tools
Find Rhymes Instantly in the App
Download RHYMEBOOK to find rhymes while you write, record demos, and share your music.
macOSComing SoonWindowsComing SoonLinuxComing Soon